Senllen Car Tent Fully Automatic 189 inch Large Size Hot Summer Anti-UV Wireless Control Vehicle Umbrella with Removable Charger, Windproof Carport Canopy Sun Shade for SUV, Minivan, Truck
$269.00
Features
Details
rdugheSeereFuyum-revurysubeghehehssummer!Whug-edgeumfdedsruuredwreessremer,hsrgeSzerUmbreprvdesveedeegshdefryurSUV,mv,rruk.SygdbyehesweergheshePUsveredmerhepsmerremperuref95°Fevehehessummerdys.Preyurvehefrmsw,rus,dr,dmrewhhshgh-quy,wdprfrprpy.
Whemesseury,rusheSeere!Desgedwhsxdjusbewdprfrpesddurbefrme,hsrumbreesuresmxmumsbydprefryurvehe.hevveu-muswhwsfresyper,gvgyuhefexbydphggweherds.Ejyhepeefmdkwgyurrsshededfrmhrsheemeswhemgsyshdprsurpre.
See,weremmedyurssfdprvde90-dyfurefudgureed15mhsfusmersuppr.Expereeheveeedrebyfurumredy,dkehefrssepwrdskeepgyurvehesfedhrughuheyer.D'ebdweherruyurr-vesheSeereFuyumw!
Discover More Best Sellers in Carports
Shop Carports
Quictent 10'X20' Heavy Duty Carport Car Canopy Party Tent Boat Shelter
Carports - Quictent 10'X20' Heavy Duty Carport Car Canopy Party Tent Boat Shelter
Carports - Caravan Canopy Car Tent Sidewalls for Carport, Garage & Shed, Domain, 10 x 20 Ft, Black (Roof and Canopy Not Included) - Portable Vehicle and Motorcycle Shelter - Large Outdoor Storage
Carports - BenefitUSA Canopy ONLY 10'x20' Carport Replacement Canopy Outdoor Tent Garage Top Tarp Shelter Cover w Ball Bungees (White)
Carports - BenefitUSA Carport Side Wall for 10x20 Tent Garage, Replacement Canopy Sidewall White (Side Wall ONLY, Frame NOT Included)
Carports - Sunjoy Carport 12 ft. x 20 ft. Outdoor Gazebo Heavy Duty Garage Car Shelter with Powder-Coated Steel Roof and Frame by AutoCove, Gray and Dark Gray
VOYSIGN Outdoor Heavy Duty Carport 10 X 20 Ft, Car Canopy with Three Reinforced Steel Cables (Green)
Carports - VOYSIGN Outdoor Heavy Duty Carport 10 X 20 Ft, Car Canopy with Three Reinforced Steel Cables (Green)
Carports - KING BIRD 10' x 20' Heavy Duty Anti-Snow Carport Peak Style Car Canopy Outdoor Instant Garage Car Tent with Reinforced Ground Bars
Carports - Carport Replacement Sidewall, Replacement Sidewall Tarp for 10' x 20' Carport Frame, Replacement Sidewall Cover, White, Top Cover and Frame Not Included
Carports - Wood Heavy Duty 18.3x12.6ft Carport Garage Outdoor Gazebo Wooden Pergola Car Shelte with Metal Roof Weatherproof Shelter for Patios, Garden, Backyard

